Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817646.1 | internal | 174 | 1-522(+) |
Amino Acid sequence : | |||
GDYTRIDFPALHRHPWSFKGYSDDRFQRACRPVHHRGHNLKHIRPRLDSCFILDVNVIDGTIMAPKTPFTKIWRMRNCGTIPWTHGTQLVWIGGDNFAPXESVQIEMSSVGLGAEEELDA AVDFVAPEIPGQYISYWRMASPSGQKFGQRVRVLIQVDPSSTDMETGVPNAQAH | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 19,556.922 | ||
Theoretical pI: | 6.768 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33585 | ||
Instability index: | 39.271 | ||
aromaticity | 0.098 | ||
GRAVY | -0.421 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.249 | ||
sheet | 0.179 |