| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817648.1 | complete | 99 | 45-344(+) |
Amino Acid sequence : | |||
| MTRNEDTVKLISAEGFEFIIDKKAAMVSQTIRNMLTSPGGFAESERGEVTFPEISTTILEKICQYFYWSLQYASGKETEFHIEPEMTLELMMAANYLHT* | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,338.814 | ||
| Theoretical pI: | 4.701 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 46.762 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.201 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.182 | ||
| sheet | 0.333 | ||