Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817658.1 | 5prime_partial | 159 | 3-482(+) |
Amino Acid sequence : | |||
GRSSIVFSLRLLKIIYQEIVMSLNVLDPLPLDVWDPLQDFSSDLTTNNLFSVFLSARVDWKETPEDHVFKAVLPGIKKEEVKVEVEDGRVLKISGHRSRDKEEKIDDXWHRIERRSGRFV WRFRLPENAKTXEVKALMENGVLTVIVPKVENNKKEASG* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 18,154.643 | ||
Theoretical pI: | 7.055 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23490 | ||
Instability index: | 44.506 | ||
aromaticity | 0.076 | ||
GRAVY | -0.404 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.210 | ||
sheet | 0.242 |