Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817666.1 | 5prime_partial | 137 | 530-117(-) |
Amino Acid sequence : | |||
FFFLCSNIILNVENLPNIFDGQIFNGISSSSASQCQKSLDIQIVRSQDEIEQCVLVNLHKFLVKFFNLFSSASIILRHIGITIHHHMHLAIFDDLRKNRTSNIREWDSVLRRDILEHVLD GLRQARHRPVDFECFFV* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 13,047.546 | ||
Theoretical pI: | 4.264 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 53.150 | ||
aromaticity | 0.051 | ||
GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.188 | ||
sheet | 0.325 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817666.1 | 3prime_partial | 117 | 180-530(+) |
Amino Acid sequence : | |||
MLEDVSAENAIPLPNITGSVLAKVIEYCKMHVVVDSNPNMSEDDRGTAEEVEKFDQEFVKVNQNTLFDLILAANYLDIKGLLALTCRTAADSIKNLSVEDVRKIFNIENDITAEEEE | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 13,047.546 | ||
Theoretical pI: | 4.264 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 53.150 | ||
aromaticity | 0.051 | ||
GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.188 | ||
sheet | 0.325 |