| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817666.1 | 5prime_partial | 137 | 530-117(-) |
Amino Acid sequence : | |||
| FFFLCSNIILNVENLPNIFDGQIFNGISSSSASQCQKSLDIQIVRSQDEIEQCVLVNLHKFLVKFFNLFSSASIILRHIGITIHHHMHLAIFDDLRKNRTSNIREWDSVLRRDILEHVLD GLRQARHRPVDFECFFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 13,047.546 | ||
| Theoretical pI: | 4.264 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 53.150 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.188 | ||
| sheet | 0.325 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817666.1 | 3prime_partial | 117 | 180-530(+) |
Amino Acid sequence : | |||
| MLEDVSAENAIPLPNITGSVLAKVIEYCKMHVVVDSNPNMSEDDRGTAEEVEKFDQEFVKVNQNTLFDLILAANYLDIKGLLALTCRTAADSIKNLSVEDVRKIFNIENDITAEEEE | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,047.546 | ||
| Theoretical pI: | 4.264 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 53.150 | ||
| aromaticity | 0.051 | ||
| GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.188 | ||
| sheet | 0.325 | ||