| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817686.1 | internal | 109 | 3-329(+) |
Amino Acid sequence : | |||
| IEMKDYEQPQDALCSPEKLVRQVKLATQQAKVPFAGENALPRYDEGAYDQIACAAEMEGGERMCAFTYLRLSPELLQNQNWVRFVGFVKKMKEGRDAGKCREEVEEAAM | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 13,069.481 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 56.433 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.222 | ||
Secondary Structure Fraction | |||
| Helix | 0.385 | ||
| turn | 0.156 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817686.1 | internal | 109 | 329-3(-) |
Amino Acid sequence : | |||
| HRRLLHFLPTLTRISPFLHLLHKPNKPHPVLILKQLRTQPQVRKRTHPLPTLHFRRTRDLIIRALIVPRQGVLASERNFSLLGRELHLPHELLRRAERVLRLLVVFHFD | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 13,069.481 | ||
| Theoretical pI: | 12.000 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 56.433 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.222 | ||
Secondary Structure Fraction | |||
| Helix | 0.385 | ||
| turn | 0.156 | ||
| sheet | 0.284 | ||