Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817688.1 | 5prime_partial | 171 | 1-516(+) |
Amino Acid sequence : | |||
APPFPNTTIIEEKWPLRNSVVAQSIVPSDHKTVSNSIPFTRLERARMSAQMVDGTTIVSFVEDEEVFDSTVRALFAKLDTDHDGLITHFGDDEVNVTPAELMGMFELFDRNSSGTIDLNE FKAETKRMLLAVASGIGFLPVQMLLEEDSLLSKAVEREYTIAHNNIYDSNA* | |||
Physicochemical properties | |||
Number of amino acids: | 171 | ||
Molecular weight: | 19,051.220 | ||
Theoretical pI: | 4.530 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 45.216 | ||
aromaticity | 0.076 | ||
GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.222 | ||
sheet | 0.287 |