| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817688.1 | 5prime_partial | 171 | 1-516(+) |
Amino Acid sequence : | |||
| APPFPNTTIIEEKWPLRNSVVAQSIVPSDHKTVSNSIPFTRLERARMSAQMVDGTTIVSFVEDEEVFDSTVRALFAKLDTDHDGLITHFGDDEVNVTPAELMGMFELFDRNSSGTIDLNE FKAETKRMLLAVASGIGFLPVQMLLEEDSLLSKAVEREYTIAHNNIYDSNA* | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 19,051.220 | ||
| Theoretical pI: | 4.530 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
| Instability index: | 45.216 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.222 | ||
| sheet | 0.287 | ||