| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817707.1 | 5prime_partial | 162 | 2-490(+) |
Amino Acid sequence : | |||
| GPVYLCPGFIRSRVLPPLIWHSHSDQVRAIIFHQRSLRSLALYLLQPSFMSELDTQIPSAFDPFADASAEDSGAGTKEYVHIRVQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNG TVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKESIKIHGF* | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 18,241.771 | ||
| Theoretical pI: | 9.349 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 42.849 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.273 | ||
Secondary Structure Fraction | |||
| Helix | 0.327 | ||
| turn | 0.228 | ||
| sheet | 0.198 | ||