| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817711.1 | 5prime_partial | 124 | 1-375(+) |
Amino Acid sequence : | |||
| GIERIQASFTDQAKRMIYVGDGKNDYCPSLKLTHKDYVMPRKNFPFWDLINANPILIKGSVHEWTDRDDFERILTKLVSMSSVDDQKTEVAPERLVGSAAECKVQKRSLVLVPEKVRKAV QVSW* | |||
Physicochemical properties | |||
| Number of amino acids: | 124 | ||
| Molecular weight: | 14,222.227 | ||
| Theoretical pI: | 8.913 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 38.096 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.438 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.194 | ||
| sheet | 0.210 | ||