Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817711.1 | 5prime_partial | 124 | 1-375(+) |
Amino Acid sequence : | |||
GIERIQASFTDQAKRMIYVGDGKNDYCPSLKLTHKDYVMPRKNFPFWDLINANPILIKGSVHEWTDRDDFERILTKLVSMSSVDDQKTEVAPERLVGSAAECKVQKRSLVLVPEKVRKAV QVSW* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 14,222.227 | ||
Theoretical pI: | 8.913 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 38.096 | ||
aromaticity | 0.081 | ||
GRAVY | -0.438 | ||
Secondary Structure Fraction | |||
Helix | 0.315 | ||
turn | 0.194 | ||
sheet | 0.210 |