| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817715.1 | 3prime_partial | 147 | 86-526(+) |
Amino Acid sequence : | |||
| MLSTGKVVLKSSDKETFEIDRSVACLSQTIKYMLEDVSAENAIPLPNITGSVLAKVIEYCKMHVVVDSNPNMSEDDRGTAEEVEKFDQEFVKVNQNTLFDLILAANYLDIKGLLALTCRT AADSIKNLSVEDVRKVFNIENDFTAXE | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 15,545.692 | ||
| Theoretical pI: | 6.762 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 65.684 | ||
| aromaticity | 0.090 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.209 | ||
| sheet | 0.179 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817715.1 | 5prime_partial | 135 | 526-119(-) |
Amino Acid sequence : | |||
| FXCSKIILNVENLPNIFDGQIFNGISSSSASQCQKSLDIQIVRSQDEIEQCVLVNLHKFLVKFFNLFSSTSIILRHIGITIHHHMHLAIFDDLRKNRTSNIGEWDSVLRRDILEHVLDGL RQARHRPVDFECFFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 15,545.692 | ||
| Theoretical pI: | 6.762 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 65.684 | ||
| aromaticity | 0.090 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.381 | ||
| turn | 0.209 | ||
| sheet | 0.179 | ||