Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817803.1 | internal | 162 | 3-488(+) |
Amino Acid sequence : | |||
ETIYYHALRASCVLAAKEGPYETYEGSPVSKGILQPDMWGVSPSDRWDWTTLRRNIAENGVRNSLLVAPMPTASTSQILGNNECFEPYTSNIYSRRVLSGEFVVVNKHLLHDLTELGFCS PDLKNSIISENGSVEKVPEIPADLEAIYKTVWEIKQRILVDM | |||
Physicochemical properties | |||
Number of amino acids: | 162 | ||
Molecular weight: | 18,203.444 | ||
Theoretical pI: | 5.072 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32430 32555 | ||
Instability index: | 59.552 | ||
aromaticity | 0.086 | ||
GRAVY | -0.248 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.265 | ||
sheet | 0.253 |