| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817841.1 | 5prime_partial | 146 | 1-441(+) |
Amino Acid sequence : | |||
| GGAGTEITMETEILRDRFRFSATSIAESEASKCGMEISEHVTACVADLAFRYTEQLGKDLELFVRHGGRKTVNMEDVVLSAHRNEPLLNLLRSHRDEMRAKAPRSTTTERRRKRALAKME DKAASSSSHPTHSMSKDVFSISPLPG* | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 14,498.730 | ||
| Theoretical pI: | 9.258 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 43.935 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.365 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.271 | ||
| sheet | 0.286 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817841.1 | 3prime_partial | 133 | 401-3(-) |
Amino Acid sequence : | |||
| MLCVGWLELEAALSSIFAKALFRLLSVVVDRGAFALISSRCDLNRFKRGSFLCAESTTSSMFTVFLPPWRTNNSRSFPSCSVYLNARSATQAVTCSDISIPHLLASDSAMEVAEKRKRSL SISVSMVISVPAP | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 14,498.730 | ||
| Theoretical pI: | 9.258 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12740 | ||
| Instability index: | 43.935 | ||
| aromaticity | 0.083 | ||
| GRAVY | 0.365 | ||
Secondary Structure Fraction | |||
| Helix | 0.323 | ||
| turn | 0.271 | ||
| sheet | 0.286 | ||