| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817861.1 | 5prime_partial | 179 | 3-542(+) |
Amino Acid sequence : | |||
| GRGGIGVGSQVYASNININAGAVIPPPVIGGGGNPNFTGLPVMPRGLAEKRKMVSEMTFEDFAQYFHLPIKLAAEQLGLCDTTIKRKLREFNLKPWPQRKITCIMKQIETITNDLSNQPD KAKRRESRTRLRELYHDLSIIYRRNVALHNLITDSDDEAGPSNTNININRTDNNQPRGN* | |||
Physicochemical properties | |||
| Number of amino acids: | 179 | ||
| Molecular weight: | 20,023.582 | ||
| Theoretical pI: | 9.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 51.447 | ||
| aromaticity | 0.056 | ||
| GRAVY | -0.611 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.291 | ||
| sheet | 0.207 | ||