| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817864.1 | complete | 123 | 51-422(+) |
Amino Acid sequence : | |||
| MSSRSIGYSANEDRILCQVYIDISQNPITGNQQSSNQFWSRIEEAYNKSRTSTWEMRTTRSLQSQIQIIEKATRKLQSCIRQVENMHPSGASEQDICRWIELKFCFERMTTIKEVSSSTM FGI* | |||
Physicochemical properties | |||
| Number of amino acids: | 123 | ||
| Molecular weight: | 14,312.012 | ||
| Theoretical pI: | 8.420 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 77.567 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.619 | ||
Secondary Structure Fraction | |||
| Helix | 0.252 | ||
| turn | 0.244 | ||
| sheet | 0.187 | ||