Acc_NO	ORF type	length	start-end position (strand +/-)
>CB817872.1	internal	141	1-423(+)
Amino Acid sequence :
GNAIRPQINSFLEGFNELVPRELISIFNDKELELLISGLPEIDLNDLKANSEYTGYTAASSVIQWFWEVVGSFSKEDMARFLQFVTGTSKVPLEGFRALQGISGPQRFQIHKAYGAPERL PSAHTCFNQLDLPEYPTKEQL
Physicochemical properties
Number of amino acids:		141
Molecular weight:		15,879.753
Theoretical pI:		4.888
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 16960
Instability index:		31.272
aromaticity		0.113
GRAVY		-0.252
Secondary Structure Fraction
Helix		0.333
turn		0.262
sheet		0.277