| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817873.1 | complete | 160 | 17-499(+) |
Amino Acid sequence : | |||
| MLPTGKVVLKSSDKETFEIDKSVACLSQTIKYMLEDVSAENAIPLPNVTGSVLAKVIEYCKMHLVVDSNPNMSEDDRSTAEEVEKFYQEFVKVNQNTLFDLIMAANYLDIKGLLALTCRT AADSIKDLSGEHVTKIFPLENDFTGQEQEDIPQEFHWAFE* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 18,013.222 | ||
| Theoretical pI: | 4.515 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 43.329 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.216 | ||
Secondary Structure Fraction | |||
| Helix | 0.313 | ||
| turn | 0.188 | ||
| sheet | 0.294 | ||