Acc_NO	ORF type	length	start-end position (strand +/-)
>CB817883.1	internal	101	3-305(+)
Amino Acid sequence :
GCSLLCFASLAGMDSQSELGLFPRHRCKTIHLVRHAQGYHNVAGEKNFDSYMPYNYLDASLTPLGWEQVDNLRKHVHATALSNNIELVISSPLTRTMQTAV
Physicochemical properties
Number of amino acids:		101
Molecular weight:		11,258.694
Theoretical pI:		7.171
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		11460 11585
Instability index:		55.502
aromaticity		0.079
GRAVY		-0.184
Secondary Structure Fraction
Helix		0.297
turn		0.248
sheet		0.277