| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817890.1 | internal | 102 | 3-308(+) |
Amino Acid sequence : | |||
| RKLADKDVKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVIFMLPWLGRTVAGTTDSNTEITMLPEPHEDEIQFILDCLCDYLNVKVRRTDVLSAWSGI | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,419.168 | ||
| Theoretical pI: | 5.224 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15595 | ||
| Instability index: | 48.877 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.225 | ||
| sheet | 0.216 | ||