| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817903.1 | 3prime_partial | 126 | 3-380(+) |
Amino Acid sequence : | |||
| MQAKVEKEMGSGQDPAAAAAEQANKEEVDGRSIFVGNVDYACTPEEVQQHFQSCGTVNRVTIRTNKFGQPKGYAYVEFLEPEAVQEAIRLNESELHGRQLKVSAKRTNIPGMKQFRPRRS GGPYMG | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 13,974.538 | ||
| Theoretical pI: | 7.772 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 63.767 | ||
| aromaticity | 0.071 | ||
| GRAVY | -0.763 | ||
Secondary Structure Fraction | |||
| Helix | 0.214 | ||
| turn | 0.246 | ||
| sheet | 0.262 | ||