Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817907.1 | 3prime_partial | 128 | 84-467(+) |
Amino Acid sequence : | |||
MLSTGKVVLKSSDKETFEIDRSVACLSQTIKYMLEDVSAENAIPLPNITGSVLAKVIEYCKMHVVVDSNPNMSEDDRGTAEEVEKFDQEFVKVNQNTLFDLILAANYLDIKGLLALTCRT AADSIKNL | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 13,527.357 | ||
Theoretical pI: | 7.251 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 66.884 | ||
aromaticity | 0.086 | ||
GRAVY | -0.063 | ||
Secondary Structure Fraction | |||
Helix | 0.371 | ||
turn | 0.190 | ||
sheet | 0.181 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817907.1 | 5prime_partial | 116 | 467-117(-) |
Amino Acid sequence : | |||
QIFNGISSSSASQCQKSLDIQIVRSQDEIEQCVLVNLHKFLVKFFNLFSSTSIILRHIGITIHHHMHLAIFDDLRKNRTSNIGEWDSVLRRDILEHVLDGLRQARHRPVDFECFFV* | |||
Physicochemical properties | |||
Number of amino acids: | 116 | ||
Molecular weight: | 13,527.357 | ||
Theoretical pI: | 7.251 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 66.884 | ||
aromaticity | 0.086 | ||
GRAVY | -0.063 | ||
Secondary Structure Fraction | |||
Helix | 0.371 | ||
turn | 0.190 | ||
sheet | 0.181 |