Acc_NO	ORF type	length	start-end position (strand +/-)
>CB817908.1	5prime_partial	161	555-70(-)
Amino Acid sequence :
SSSIHSCSHLLVIIFLATGIIIILIIYLRLGLVRFLLSNIPTVLFVVVNIHVLLVLPLPLLSLLNIRSFIIVSHVFPLCPSGFPDRSNRLVVRILLLELLPELFHETEEGAGRPLRLVRV LGSLTPLLDTQLGISTLGDGLRLSLHVDELLGLGFASERKR*
Physicochemical properties
Number of amino acids:		161
Molecular weight:		15,277.602
Theoretical pI:		6.427
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		40.457
aromaticity		0.066
GRAVY		-1.641
Secondary Structure Fraction
Helix		0.132
turn		0.250
sheet		0.235

Acc_NO	ORF type	length	start-end position (strand +/-)
>CB817908.1	complete	136	118-528(+)
Amino Acid sequence :
MKGKAKSVSKRGDPKLGVKKGRKAAKDPNKPKRPPSAFFGFMEEFRKQFKEKNPNNKSVAAVGKAAGAEWKNMTDDDKAPYVEKAEKRKRQYEKDMNVYNNKQDGGDVAEEESDKSKSEV NDEDDDDASGEEDDDQ*
Physicochemical properties
Number of amino acids:		136
Molecular weight:		15,277.602
Theoretical pI:		6.427
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		40.457
aromaticity		0.066
GRAVY		-1.641
Secondary Structure Fraction
Helix		0.132
turn		0.250
sheet		0.235