Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817918.1 | 5prime_partial | 156 | 3-473(+) |
Amino Acid sequence : | |||
ALSSNVLILITLSCVPLSTLILLMDSSLVSQMSIDQENYCWGSNKKTERGGNKMGEAKGGQRRREMKPASMDFSSQLPESIIVTILSLLPLKDAVRTSVLARSWRQSGAPGLILKSTTNT SLAIQAVPSCALNTLVLNLASSGSSVIRTQPSKVSP* | |||
Physicochemical properties | |||
Number of amino acids: | 156 | ||
Molecular weight: | 16,631.161 | ||
Theoretical pI: | 9.780 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
Instability index: | 62.899 | ||
aromaticity | 0.026 | ||
GRAVY | 0.086 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.321 | ||
sheet | 0.269 |