Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817959.1 | 5prime_partial | 100 | 316-14(-) |
Amino Acid sequence : | |||
SLLNIRSFIIVSHVFPLCPSGFPDRSNRLVVRILLLELLPELFHENEEGAGRPLRLVRVLDSLTPLLDTQLGISTLGDGLRLSLHVDELLGLGFASERKR* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,151.899 | ||
Theoretical pI: | 6.257 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 44.711 | ||
aromaticity | 0.050 | ||
GRAVY | 0.266 | ||
Secondary Structure Fraction | |||
Helix | 0.410 | ||
turn | 0.260 | ||
sheet | 0.330 |