| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817960.1 | internal | 135 | 2-406(+) |
Amino Acid sequence : | |||
| ALFDKGTEKLHARHDSSSSSSDDEKPLPAASAVHAGTGNSPPSSSSAPSSPSSIRSKIHRIFGREQPLHKVLGGGKSADIFLWRNEKKSGSVIGVATMIWFLFEVLGYHLLTLICYMMMA SLAILLLWANATSFI | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 14,541.537 | ||
| Theoretical pI: | 9.211 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19480 | ||
| Instability index: | 57.774 | ||
| aromaticity | 0.081 | ||
| GRAVY | 0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.311 | ||
| sheet | 0.274 | ||