Acc_NO	ORF type	length	start-end position (strand +/-)
>CB817960.1	internal	135	2-406(+)
Amino Acid sequence :
ALFDKGTEKLHARHDSSSSSSDDEKPLPAASAVHAGTGNSPPSSSSAPSSPSSIRSKIHRIFGREQPLHKVLGGGKSADIFLWRNEKKSGSVIGVATMIWFLFEVLGYHLLTLICYMMMA SLAILLLWANATSFI
Physicochemical properties
Number of amino acids:		135
Molecular weight:		14,541.537
Theoretical pI:		9.211
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		19480 19480
Instability index:		57.774
aromaticity		0.081
GRAVY		0.039
Secondary Structure Fraction
Helix		0.296
turn		0.311
sheet		0.274