| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817962.1 | 3prime_partial | 126 | 82-459(+) |
Amino Acid sequence : | |||
| MLSTGKVVLKSSDKETFEIDRSVACLSQTIKYMLEDVSAENAIPLPNITGSVLAKVIEYCKMHVVVDSNPNMSEDDRGTAEEVEKFDQEFVKVNQNTLFDLILAANYLDIKGLLALTCRT AADSIK | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 13,287.012 | ||
| Theoretical pI: | 6.457 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 68.135 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.069 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.193 | ||
| sheet | 0.193 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817962.1 | 5prime_partial | 114 | 459-115(-) |
Amino Acid sequence : | |||
| FNGISSSSASQCQKSLDIQIVRSQDEIEQCVLVNLHKFLVEFFNLFSSTSIILRHIGITIHHHMHLAIFDDLRKNRTSNIGEWDSVLRRDILEHVLDGLRQARHRPVDFECFFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 13,287.012 | ||
| Theoretical pI: | 6.457 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 68.135 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.069 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.193 | ||
| sheet | 0.193 | ||