| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817980.1 | internal | 111 | 3-335(+) |
Amino Acid sequence : | |||
| DNAVKNRFTTLSKQRAKREALAKENNTTTCFNANNKRAISSTGLTLEEKARNVTSPFKKMRMAHIPSHPKTGNIASISDRDLLTDKQNLRAPFTVLARDVCKSQISLPSNQ | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,369.954 | ||
| Theoretical pI: | 10.398 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 48.241 | ||
| aromaticity | 0.036 | ||
| GRAVY | -0.766 | ||
Secondary Structure Fraction | |||
| Helix | 0.198 | ||
| turn | 0.252 | ||
| sheet | 0.234 | ||