Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB817993.1 | internal | 111 | 3-335(+) |
Amino Acid sequence : | |||
LSTNKPMNRRPLVGESSKCILPAIGLHLNAVASKDCRPSEKLSSEMLPVPLVKSCEPLPSPTTGPDTLEITAPDSLEKDGGIFDMEVQIGEEASQGSANAVNDDLTQNSPK | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 11,727.130 | ||
Theoretical pI: | 4.639 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 58.874 | ||
aromaticity | 0.009 | ||
GRAVY | -0.416 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.342 | ||
sheet | 0.279 |