| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB817993.1 | internal | 111 | 3-335(+) |
Amino Acid sequence : | |||
| LSTNKPMNRRPLVGESSKCILPAIGLHLNAVASKDCRPSEKLSSEMLPVPLVKSCEPLPSPTTGPDTLEITAPDSLEKDGGIFDMEVQIGEEASQGSANAVNDDLTQNSPK | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 11,727.130 | ||
| Theoretical pI: | 4.639 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
| Instability index: | 58.874 | ||
| aromaticity | 0.009 | ||
| GRAVY | -0.416 | ||
Secondary Structure Fraction | |||
| Helix | 0.216 | ||
| turn | 0.342 | ||
| sheet | 0.279 | ||