Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818024.1 | 3prime_partial | 130 | 84-473(+) |
Amino Acid sequence : | |||
MLSTGKVVLKSSDKETFEIDRSVACLSQTIKYMLEDVSAENAIPLPNITGSVLAKVIEYCKMHVVVDSNPNMSEDDRGTAEEVEKFDQEFVKVNQNTLFDLILAANYLDIKGLLALTCRT AADSIKNLSV | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 13,699.496 | ||
Theoretical pI: | 6.763 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 65.920 | ||
aromaticity | 0.085 | ||
GRAVY | -0.095 | ||
Secondary Structure Fraction | |||
Helix | 0.364 | ||
turn | 0.195 | ||
sheet | 0.178 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818024.1 | 5prime_partial | 118 | 473-117(-) |
Amino Acid sequence : | |||
DGQIFNGISSSSASQCQKSLDIQIVRSQDEIEQCVLVNLHKFLVKFFNLFSSTSIILRHIGITIHHHMHLAIFDDLRKNRTSNIGEWDSVLRRDILEHVLDGLRQARHRPVDFECFFV* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 13,699.496 | ||
Theoretical pI: | 6.763 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 65.920 | ||
aromaticity | 0.085 | ||
GRAVY | -0.095 | ||
Secondary Structure Fraction | |||
Helix | 0.364 | ||
turn | 0.195 | ||
sheet | 0.178 |