| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818028.1 | 5prime_partial | 131 | 1-396(+) |
Amino Acid sequence : | |||
| GVCFFFYLRLGVKKGGRKAAKDPNKPKRPPSAFFVFMEEFRKQFKEKNPNNKSVAAVGKAAGAEWKNMTDEDKAPYVEKAEKRKRQYEKDMNVYNNKQDGVDVAEEESDKSKSEVNDEDD DDASGEEDDDE* | |||
Physicochemical properties | |||
| Number of amino acids: | 131 | ||
| Molecular weight: | 14,968.275 | ||
| Theoretical pI: | 5.040 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 46.005 | ||
| aromaticity | 0.099 | ||
| GRAVY | -1.360 | ||
Secondary Structure Fraction | |||
| Helix | 0.191 | ||
| turn | 0.221 | ||
| sheet | 0.252 | ||