Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818043.1 | 5prime_partial | 142 | 1-429(+) |
Amino Acid sequence : | |||
GLQFIDMKGKAKSVSKRGDPKLGVKKGRKAAKDPNKPKRPPSAFFVFMEEFRKQFKEKNPNNKSVAAVGKAAGAEWKNMTDDDKAPYVEKAEERKRQYEKDMNVYNNKQDGGDVAEEESD KSKSEVNDEDDDDASGEEDDDE* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 15,995.365 | ||
Theoretical pI: | 5.182 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
Instability index: | 40.935 | ||
aromaticity | 0.070 | ||
GRAVY | -1.511 | ||
Secondary Structure Fraction | |||
Helix | 0.155 | ||
turn | 0.239 | ||
sheet | 0.246 |