| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818048.1 | internal | 149 | 1-447(+) |
Amino Acid sequence : | |||
| GYPTTTTTILANLLKNGGFEEGPYVFPNSTTGTMIPPNIEDDHSPLPGWMIASLKAVKFIDSAHFSVPSGKRAVELVAGKESVIVQIVRTIPGKTYALTFAVGDANNACNDSMVVEAFAN EHTLKVPYQSKGRGGFKRAILKFVAKQPR | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 12,864.091 | ||
| Theoretical pI: | 4.444 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
| Instability index: | 14.200 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.135 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.233 | ||
| sheet | 0.283 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818048.1 | 5prime_partial | 120 | 447-85(-) |
Amino Acid sequence : | |||
| PWLFRDELENGALESASTLGLVRHLESVLVGERLYDHRVVAGVVCVSDGERECVGLSRDGPDDLDYHALLTGDKLHRALAGWDGEVGGVDELDGLKGGDHPAGEWGVVVFDVGWDHCAGC * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,864.091 | ||
| Theoretical pI: | 4.444 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 24980 25230 | ||
| Instability index: | 14.200 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.135 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.233 | ||
| sheet | 0.283 | ||