| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818056.1 | internal | 127 | 3-383(+) |
Amino Acid sequence : | |||
| HAVGALLTMCESDRSKYREPILSEGVIPGLLELTVQGTPKCRAKAQTLLRLLRDSPYGSRSDLQPDTLHNIVCNIISRIEMETEDEQGGKAKKMLAKMVQVSMEQSWKHLQKRASLGCTD PLSDLPV | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,102.206 | ||
| Theoretical pI: | 7.858 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 68.109 | ||
| aromaticity | 0.024 | ||
| GRAVY | -0.368 | ||
Secondary Structure Fraction | |||
| Helix | 0.260 | ||
| turn | 0.220 | ||
| sheet | 0.299 | ||