Acc_NO	ORF type	length	start-end position (strand +/-)
>CB818056.1	internal	127	3-383(+)
Amino Acid sequence :
HAVGALLTMCESDRSKYREPILSEGVIPGLLELTVQGTPKCRAKAQTLLRLLRDSPYGSRSDLQPDTLHNIVCNIISRIEMETEDEQGGKAKKMLAKMVQVSMEQSWKHLQKRASLGCTD PLSDLPV
Physicochemical properties
Number of amino acids:		127
Molecular weight:		14,102.206
Theoretical pI:		7.858
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8730
Instability index:		68.109
aromaticity		0.024
GRAVY		-0.368
Secondary Structure Fraction
Helix		0.260
turn		0.220
sheet		0.299