| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818063.1 | 3prime_partial | 103 | 38-346(+) |
Amino Acid sequence : | |||
| MALTKAWKEVCGTGGKVLIPKGDHLLGPVTLEGPCKGPVGIEVAGNLNAPPEVAAFKGIDGWININHVEGLTITAVGKGSGVFDGKGEVFWKANDCSKNPKCS | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,613.169 | ||
| Theoretical pI: | 7.660 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16750 | ||
| Instability index: | 14.899 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.016 | ||
Secondary Structure Fraction | |||
| Helix | 0.282 | ||
| turn | 0.320 | ||
| sheet | 0.214 | ||