| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818069.1 | 3prime_partial | 145 | 84-518(+) |
Amino Acid sequence : | |||
| MLSTGKVVLKSSDKETFEIDRSVACLSQTIKYMPEDVSAENAIPLPNITGSVLAKVIEYCKMHVVVDSNPNMSEDDRGTAEEVEKFDQEFVKVNQNTLFDLILAANYLDIKGLLALTCRT AADSIKNLSVEDVRKIFNIENDFTA | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 13,758.175 | ||
| Theoretical pI: | 11.307 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29365 | ||
| Instability index: | 103.011 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.213 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.263 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818069.1 | 5prime_partial | 133 | 518-117(-) |
Amino Acid sequence : | |||
| CSKIILNVENLPNIFDGQIFNGISSSSASQCQKSLDIQIVRSQDEIEQCVLINLHKFLVKFFNLFGSTSIILRHIGITIHHHMHLAIFDDLRKNRTSNIGEWDSVLRRDILGHVLDGLRQ ARHRPVDFECFFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 13,758.175 | ||
| Theoretical pI: | 11.307 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29365 | ||
| Instability index: | 103.011 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.213 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.263 | ||
| sheet | 0.220 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818069.1 | 5prime_partial | 118 | 1-357(+) |
Amino Acid sequence : | |||
| GDSLLSLSSSHILIYPPHALIESWGKQTCCQQERSFSSLQTKKHSKSTGLWRACLRPSSTCPRMSRRRTLSHSPILLVRFLRRSSNIARCMWWWIVIPICLRMIEVLPKRLKNLTRNL* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,758.175 | ||
| Theoretical pI: | 11.307 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29365 | ||
| Instability index: | 103.011 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.213 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.263 | ||
| sheet | 0.220 | ||