Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818069.1 | 3prime_partial | 145 | 84-518(+) |
Amino Acid sequence : | |||
MLSTGKVVLKSSDKETFEIDRSVACLSQTIKYMPEDVSAENAIPLPNITGSVLAKVIEYCKMHVVVDSNPNMSEDDRGTAEEVEKFDQEFVKVNQNTLFDLILAANYLDIKGLLALTCRT AADSIKNLSVEDVRKIFNIENDFTA | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 13,758.175 | ||
Theoretical pI: | 11.307 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29365 | ||
Instability index: | 103.011 | ||
aromaticity | 0.068 | ||
GRAVY | -0.213 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.263 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818069.1 | 5prime_partial | 133 | 518-117(-) |
Amino Acid sequence : | |||
CSKIILNVENLPNIFDGQIFNGISSSSASQCQKSLDIQIVRSQDEIEQCVLINLHKFLVKFFNLFGSTSIILRHIGITIHHHMHLAIFDDLRKNRTSNIGEWDSVLRRDILGHVLDGLRQ ARHRPVDFECFFV* | |||
Physicochemical properties | |||
Number of amino acids: | 133 | ||
Molecular weight: | 13,758.175 | ||
Theoretical pI: | 11.307 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29365 | ||
Instability index: | 103.011 | ||
aromaticity | 0.068 | ||
GRAVY | -0.213 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.263 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818069.1 | 5prime_partial | 118 | 1-357(+) |
Amino Acid sequence : | |||
GDSLLSLSSSHILIYPPHALIESWGKQTCCQQERSFSSLQTKKHSKSTGLWRACLRPSSTCPRMSRRRTLSHSPILLVRFLRRSSNIARCMWWWIVIPICLRMIEVLPKRLKNLTRNL* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 13,758.175 | ||
Theoretical pI: | 11.307 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29365 | ||
Instability index: | 103.011 | ||
aromaticity | 0.068 | ||
GRAVY | -0.213 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.263 | ||
sheet | 0.220 |