| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818072.1 | internal | 207 | 3-623(+) |
Amino Acid sequence : | |||
| EIGAGKRIPLSLHCLSFSPNVVGQVSVLPLRRKAAMAWSGGAVHYLRLFMEETNFYNHLVLNYTLPAKAWEPLPHFFQTWLRNFIGGILIYLISGLLWSFYIYHFKRNVYIPKDCIPSRK AMLLQIKVAMKAMPWYTLLPTVSEYMIEQGWTRCYPRIGDIGLPAYVGYLAVYLALVEFGIYWMHRELHDIKPLYKYLHATHHIYNK | |||
Physicochemical properties | |||
| Number of amino acids: | 207 | ||
| Molecular weight: | 16,475.680 | ||
| Theoretical pI: | 9.792 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 66.523 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.568 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.299 | ||
| sheet | 0.259 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818072.1 | 5prime_partial | 147 | 2-445(+) |
Amino Acid sequence : | |||
| GDWRWKENPSLSPLFVLFPQRCRPSVSSTAAAKGGNGMERRRRSLPKTLHGGDKLLQPPSVELYPTGESLGAVAPFLPDLAKKLHRWDPDLPHLRPSLVLLHLPLQTQRLYPQRLHPLKE SHAVADKSCNESNAVVYPSSHGFRVHD* | |||
Physicochemical properties | |||
| Number of amino acids: | 147 | ||
| Molecular weight: | 16,475.680 | ||
| Theoretical pI: | 9.792 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 66.523 | ||
| aromaticity | 0.068 | ||
| GRAVY | -0.568 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.299 | ||
| sheet | 0.259 | ||