| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818082.1 | internal | 130 | 2-391(+) |
Amino Acid sequence : | |||
| GCALFPLHLFFFFSDLISEKTHCAHYLRYSFTMAEHPGDSEVHQESLFDKVTEKLHARHDSSSSSSDDEKPLPAASAVHAGTGNSPPSSSSAPSSPSSIRSKIHRIFGREQPLHKVLGGG KSADIFLWRN | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 11,623.682 | ||
| Theoretical pI: | 4.562 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23740 | ||
| Instability index: | 86.101 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.745 | ||
Secondary Structure Fraction | |||
| Helix | 0.192 | ||
| turn | 0.288 | ||
| sheet | 0.308 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818082.1 | 5prime_partial | 104 | 390-76(-) |
Amino Acid sequence : | |||
| FLHRKISADLPPPRTLCRGCSRPKMRWILERMEDGEEGADDEEGGEFPVPACTADAAGSGFSSSEEEEEESWRAWSFSVTLSKRDSWCTSESPGCSAMVNEYLR* | |||
Physicochemical properties | |||
| Number of amino acids: | 104 | ||
| Molecular weight: | 11,623.682 | ||
| Theoretical pI: | 4.562 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23740 | ||
| Instability index: | 86.101 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.745 | ||
Secondary Structure Fraction | |||
| Helix | 0.192 | ||
| turn | 0.288 | ||
| sheet | 0.308 | ||