Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818087.1 | internal | 152 | 3-458(+) |
Amino Acid sequence : | |||
GRKLEPSHPRYPSHSLSISFSPRRTLTLEVHRHEGKGEVRFQARDPKLGVRKGGRKAAKDPNKPKRPPSAFFVFMEEFRKQFKEKNPNNKSVAAVGKAAGAEWKNMTDEDKAPYVEKAEK RKRQYEKDMNVYNNKQDGVDVAEEESDKSKSE | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 14,038.626 | ||
Theoretical pI: | 7.031 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 57.998 | ||
aromaticity | 0.089 | ||
GRAVY | 0.747 | ||
Secondary Structure Fraction | |||
Helix | 0.484 | ||
turn | 0.266 | ||
sheet | 0.323 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818087.1 | 5prime_partial | 124 | 458-84(-) |
Amino Acid sequence : | |||
LRLGLVRLLLSNINTVLFVVVNIHVLLVLPLPLLSLFNIRSFILVSHVFPLCPSSFPDRSNRLVVRILLLELLPELFHENEEGAGRPLWLVRVLGSLTPPLPDTQLGISRLETDFAFPFM SMNF* | |||
Physicochemical properties | |||
Number of amino acids: | 124 | ||
Molecular weight: | 14,038.626 | ||
Theoretical pI: | 7.031 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 57.998 | ||
aromaticity | 0.089 | ||
GRAVY | 0.747 | ||
Secondary Structure Fraction | |||
Helix | 0.484 | ||
turn | 0.266 | ||
sheet | 0.323 |