| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818095.1 | internal | 150 | 2-451(+) |
Amino Acid sequence : | |||
| GNWQDEDYLLPKDPPFGDLSQSLWENATQEDDISYIFEESTPIKACGGVSHHFIQHGDSNKTTQEYRETEAFSQPQLKRRRMLQFDDKNVNATLQFDDSFLKSKERIDALGDISADLAEW DMDISTLEEDLSSAGLECLDQAEGWIIDCL | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 17,125.490 | ||
| Theoretical pI: | 4.144 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 59.743 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.723 | ||
Secondary Structure Fraction | |||
| Helix | 0.267 | ||
| turn | 0.207 | ||
| sheet | 0.267 | ||