Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818100.1 | complete | 136 | 101-511(+) |
Amino Acid sequence : | |||
MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTI MPEDIQLARRIRGERA* | |||
Physicochemical properties | |||
Number of amino acids: | 136 | ||
Molecular weight: | 15,406.820 | ||
Theoretical pI: | 10.987 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4470 | ||
Instability index: | 41.068 | ||
aromaticity | 0.051 | ||
GRAVY | -0.599 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.132 | ||
sheet | 0.301 |