Acc_NO	ORF type	length	start-end position (strand +/-)
>CB818117.1	internal	179	2-538(+)
Amino Acid sequence :
DNDIIFLINPGSSHWKCSAKDHHTKSSAVGSSINKNEYVESEDRKVNADVPPLDVVFVHGLRGGPFKTWRISEDKSSTKSGLVEKIDQEAGKEGTFWPGEWLSADFPDARLFSLKYKSNL TQWSGASLPLQEVSSMLLERLVAAGIGNRPVVFVTHSMGGLVVKQMLYQAKTENLDSFV
Physicochemical properties
Number of amino acids:		179
Molecular weight:		19,781.101
Theoretical pI:		6.229
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		31970 31970
Instability index:		28.089
aromaticity		0.089
GRAVY		-0.338
Secondary Structure Fraction
Helix		0.307
turn		0.285
sheet		0.223