Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818131.1 | complete | 113 | 47-388(+) |
Amino Acid sequence : | |||
MFRQACRLLARSASSSAAANGASRSFSAEVAATPAVDSTFVETWKKLMPNMDPPKTPSAYMKPRPGTPTSIPTKLTVNLALPYSSVLASKEVDMVIIPATTGQMVSCLGTLPQ* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 13,060.502 | ||
Theoretical pI: | 11.791 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 84.528 | ||
aromaticity | 0.044 | ||
GRAVY | -1.111 | ||
Secondary Structure Fraction | |||
Helix | 0.221 | ||
turn | 0.283 | ||
sheet | 0.204 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818131.1 | 5prime_partial | 113 | 430-89(-) |
Amino Acid sequence : | |||
HSPHELTGRQASTQLLWQRAQARHHLPSCSWNNNHVHLFGSKDRRVRESEIDGELGWDGSRGPRAGLHISGRGLWGVHIRHQLLPCLHERRVNGRRRRDLRREASRRPIGGGR* | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 13,060.502 | ||
Theoretical pI: | 11.791 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22125 | ||
Instability index: | 84.528 | ||
aromaticity | 0.044 | ||
GRAVY | -1.111 | ||
Secondary Structure Fraction | |||
Helix | 0.221 | ||
turn | 0.283 | ||
sheet | 0.204 |