| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818136.1 | internal | 146 | 2-439(+) |
Amino Acid sequence : | |||
| GLKPPTSSPTNSLKTPPDNPIQKQKPFHNPQLNFFLKKMRCSNAIVGFLNFLTFVFSFLVLGGGIWLSRKSMSDCEKFLDKPMIVNGVFLLLVSIAGLIGTCCKVNWLLWAYLLVMFVLI VLLFCFTVFAFVVTNKGAGEALGGKG | |||
Physicochemical properties | |||
| Number of amino acids: | 146 | ||
| Molecular weight: | 11,485.453 | ||
| Theoretical pI: | 10.958 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 58.512 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.414 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.253 | ||
| sheet | 0.212 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818136.1 | 3prime_partial | 99 | 297-1(-) |
Amino Acid sequence : | |||
| MRPAMETRRRKTPFTIMGLSRNFSQSDIDLRLSHIPPPRTRKEKTKVRKLRKPTIAFEHLIFFKKKFSCGLWNGFCFWMGLSGGVLREFVGEEVGGLSP | |||
Physicochemical properties | |||
| Number of amino acids: | 99 | ||
| Molecular weight: | 11,485.453 | ||
| Theoretical pI: | 10.958 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 58.512 | ||
| aromaticity | 0.111 | ||
| GRAVY | -0.414 | ||
Secondary Structure Fraction | |||
| Helix | 0.293 | ||
| turn | 0.253 | ||
| sheet | 0.212 | ||