Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818136.1 | internal | 146 | 2-439(+) |
Amino Acid sequence : | |||
GLKPPTSSPTNSLKTPPDNPIQKQKPFHNPQLNFFLKKMRCSNAIVGFLNFLTFVFSFLVLGGGIWLSRKSMSDCEKFLDKPMIVNGVFLLLVSIAGLIGTCCKVNWLLWAYLLVMFVLI VLLFCFTVFAFVVTNKGAGEALGGKG | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 11,485.453 | ||
Theoretical pI: | 10.958 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 58.512 | ||
aromaticity | 0.111 | ||
GRAVY | -0.414 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.253 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818136.1 | 3prime_partial | 99 | 297-1(-) |
Amino Acid sequence : | |||
MRPAMETRRRKTPFTIMGLSRNFSQSDIDLRLSHIPPPRTRKEKTKVRKLRKPTIAFEHLIFFKKKFSCGLWNGFCFWMGLSGGVLREFVGEEVGGLSP | |||
Physicochemical properties | |||
Number of amino acids: | 99 | ||
Molecular weight: | 11,485.453 | ||
Theoretical pI: | 10.958 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
Instability index: | 58.512 | ||
aromaticity | 0.111 | ||
GRAVY | -0.414 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.253 | ||
sheet | 0.212 |