| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818138.1 | 5prime_partial | 127 | 3-386(+) |
Amino Acid sequence : | |||
| QRKSVMNKLLLGFTKYPNLSSVPDDYRHFKYVLFKEVSQSDGVSYGIYVMEFMELLQDDISKVCRDYFKRKSIIELWRSEITAVLLLQEENWLKEGRQRAALGFEKVFGKKERFNVVSDY KLRRKDI* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 15,185.419 | ||
| Theoretical pI: | 9.407 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
| Instability index: | 43.460 | ||
| aromaticity | 0.134 | ||
| GRAVY | -0.479 | ||
Secondary Structure Fraction | |||
| Helix | 0.378 | ||
| turn | 0.173 | ||
| sheet | 0.236 | ||