Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818138.1 | 5prime_partial | 127 | 3-386(+) |
Amino Acid sequence : | |||
QRKSVMNKLLLGFTKYPNLSSVPDDYRHFKYVLFKEVSQSDGVSYGIYVMEFMELLQDDISKVCRDYFKRKSIIELWRSEITAVLLLQEENWLKEGRQRAALGFEKVFGKKERFNVVSDY KLRRKDI* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 15,185.419 | ||
Theoretical pI: | 9.407 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21430 | ||
Instability index: | 43.460 | ||
aromaticity | 0.134 | ||
GRAVY | -0.479 | ||
Secondary Structure Fraction | |||
Helix | 0.378 | ||
turn | 0.173 | ||
sheet | 0.236 |