Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818152.1 | complete | 160 | 86-568(+) |
Amino Acid sequence : | |||
MLPTGKVVLKSSDKETFEIDKSVACLSQTIKYMLEDVSAENAIPLPNVTGSVLAKVIEYCKMHLVVDSNPNMSEDDRSTAEEVEKFDQEFVKVNQNTLFDLIMAANYLDVKGLLALTCRT AADSIKDLSVEDVRKIFNIENDFTAEEEEEIRKEFQWAFE* | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 18,123.333 | ||
Theoretical pI: | 4.441 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 52.401 | ||
aromaticity | 0.075 | ||
GRAVY | -0.245 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.169 | ||
sheet | 0.313 |