| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818158.1 | 3prime_partial | 145 | 79-513(+) |
Amino Acid sequence : | |||
| MLPTGKVVLKSSDKETFEIDKSVACLSQTIKYMLEDVSAENAIPLPNVTGSVLAKVIEYCKMHLVVDSNPNMSEDDRSTAEEFEKFDQEFVRVNQNTLFDLIMAANYLDIKGLLALTCRT AADSIKDLSVEDVGKIFNIENDFTA | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,133.203 | ||
| Theoretical pI: | 4.434 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 46.729 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.079 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.193 | ||
| sheet | 0.290 | ||