Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818164.1 | 5prime_partial | 119 | 376-17(-) |
Amino Acid sequence : | |||
YGNRKYQSYLRRKCRNIITNSSLISYVDLDATTPNTFDGAYYTNLLKKIGTLYTDQILETDPRTTRLVHSLADEPSLFNYMFSDAMVRLGNILADDDDDDDDDPGEVRLTCSRRLNDDY* | |||
Physicochemical properties | |||
Number of amino acids: | 119 | ||
Molecular weight: | 13,733.997 | ||
Theoretical pI: | 4.520 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13535 | ||
Instability index: | 36.172 | ||
aromaticity | 0.101 | ||
GRAVY | -0.700 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.210 | ||
sheet | 0.202 |