| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818177.1 | 3prime_partial | 129 | 18-404(+) |
Amino Acid sequence : | |||
| MLSTGKVVHKSSDKETFEVDRSVACLSQTIKYMLEDVSAENAIPLPNITGSVLAKVIEYCKMHVVVDSNPNMSEDDRGTAEEVEKFDQEFVKVNQNTLFDLILAANYLDIKGLLALTCRT AADSIKNLS | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,584.408 | ||
| Theoretical pI: | 7.251 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 66.398 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.066 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.197 | ||
| sheet | 0.179 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >CB818177.1 | 5prime_partial | 117 | 404-51(-) |
Amino Acid sequence : | |||
| GQIFNGISSSSASQCQKSLDIQIVRSQDEIEQCVLVNLHKFLVKFFNLFSSTSIILRHIGITIHHHMHLAIFDDLRKNRTSNIGEWDSVLRRDILEHVLDGLRQARHRPVDFECFFV* | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 13,584.408 | ||
| Theoretical pI: | 7.251 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 66.398 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.066 | ||
Secondary Structure Fraction | |||
| Helix | 0.368 | ||
| turn | 0.197 | ||
| sheet | 0.179 | ||