Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818183.1 | internal | 125 | 3-377(+) |
Amino Acid sequence : | |||
DRTRTGVVCGLGKKLKDMMDEFQELRHRMQEEYKETIERRYFTITGEKADEATIDNLISSGESENILHKAIQLEQGRGKIMDTISEIQERHDAVKEIEKSLLELHQLFLDMAALVESQGH QLNST | |||
Physicochemical properties | |||
Number of amino acids: | 125 | ||
Molecular weight: | 12,297.627 | ||
Theoretical pI: | 9.617 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
Instability index: | 67.042 | ||
aromaticity | 0.090 | ||
GRAVY | 0.581 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.342 | ||
sheet | 0.225 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818183.1 | 3prime_partial | 111 | 334-2(-) |
Amino Acid sequence : | |||
MSKKSWCSSSKLFSISLTASCLSCISEMVSIIFPLPCSNWIALCKIFSLSPLEMRLSMVASSAFSPVMVKYRRSIVSLYSSCILCLSSWNSSIMSLSFLPKPHTTPVRVRS | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,297.627 | ||
Theoretical pI: | 9.617 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19855 | ||
Instability index: | 67.042 | ||
aromaticity | 0.090 | ||
GRAVY | 0.581 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.342 | ||
sheet | 0.225 |