Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818189.1 | internal | 181 | 2-544(+) |
Amino Acid sequence : | |||
GCALFPLHLFFFFSDLISEKTHCAHYLRYSFTMAEHPGDSEVHQESLFDKVTEKLHARHDSSSSSSDDEKPLPAASAVHAGTGNSPPSSSSAPSSPSSIRSKIHRIFGREQPLHKVLGGG KSADIFLWRNKKKSGSVIGVATMIWFLFEVLEYHLLTLICYMMMASLAILLLWANATSFIN | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 20,026.686 | ||
Theoretical pI: | 7.325 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 56.507 | ||
aromaticity | 0.105 | ||
GRAVY | -0.017 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.276 | ||
sheet | 0.271 |