Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818194.1 | complete | 160 | 84-566(+) |
Amino Acid sequence : | |||
MLSTGKVVLKSSDKETFEIDRSVACLSQTIKYMLEDVSAENAIPLPNITGSVLAKVIEYCKMHVVVDSNPNMSEDDRGTAEEVEKFDQEFVKVNQNTLFDLILAANYLDIKGLLALTCRT AADSIKNLSVEDVRKIFNIENDFTAEEEEEIRKEFQWAFE* | |||
Physicochemical properties | |||
Number of amino acids: | 160 | ||
Molecular weight: | 18,106.286 | ||
Theoretical pI: | 4.482 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 53.554 | ||
aromaticity | 0.075 | ||
GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.175 | ||
sheet | 0.306 |