Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818200.1 | 5prime_partial | 137 | 2-415(+) |
Amino Acid sequence : | |||
VVDQVTQYHLTSAAGTFCYMDPEYQQTGMLTTRSDVYSLGILLLQIITARPPVGLSHHVQRAIQRGSFEQVLDPTIKDWPVQEALRFAEIALKCAEMRKKDRPDLAKVVLPELLRLKNFG MLEREEDQKEADATPSP* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 11,509.836 | ||
Theoretical pI: | 5.429 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 42.815 | ||
aromaticity | 0.157 | ||
GRAVY | 0.432 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.389 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>CB818200.1 | 5prime_partial | 108 | 498-172(-) |
Amino Acid sequence : | |||
LCASSSLLGPFYLFFFYIYGPDSLDSVPQGEGVASASFWSSSLSNIPKFFSLSSSGSTTLARSGLSFFLISAHFNAISANLSASWTGQSLMVGSNTCSKDPLWIALWT* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,509.836 | ||
Theoretical pI: | 5.429 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 42.815 | ||
aromaticity | 0.157 | ||
GRAVY | 0.432 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.389 | ||
sheet | 0.231 |